CISBP-RNA Database: Catalog of Inferred Sequence Binding Preferences of RNA binding proteins

RBP Information

ENSCSAVG00000001132 *(Ciona savignyi)* RRM
Pfam ID	Interpro ID	Gene ID	CISBP-RNA ID	Sequence source
PF00076 (RRM_1)	IPR000504	ENSCSAVG00000001132	T35945_0.6	Ensembl (2011-Oct-26)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Sequence Logo	IUPAC	Type/Study/Study ID	RBD Identity
No direct experiments
Motifs from related RBPs
Name/Motif ID	Species	Sequence Logo	IUPAC	Type/Study/Study ID	RBD Identity
ENSDARG00000058818 M238_0.6	Danio rerio		KWGUGUG	RNAcompete Ray et al.(2013) RNCMPT00283	0.899
RBM24 M175_0.6	Homo sapiens		WGWGUGD	RNAcompete Ray et al.(2013) RNCMPT00184	0.855
Rbm38 M049_0.6	Mus musculus		KKGUGUK	RNAcompete Ray et al.(2013) RNCMPT00051	0.855
ENSTNIG00000009181 M240_0.6	Tetraodon nigroviridis		WGUGUG	RNAcompete Ray et al.(2013) RNCMPT00285	0.841
sup-12 M170_0.6	Caenorhabditis elegans		WGUGUGD	RNAcompete Ray et al.(2013) RNCMPT00179	0.768
For this family, RBPs with RBD identity > 0.7* will likely have a similar motif*

RNA Binding Domains

Protein ID	Domain	From	To	Sequence
ENSCSAVP00000001938	RRM	13	80	IFVGGLPYHTTDASLRDYFATFGDIEEAVVITDRQTGKSRGYGFVTMSEKSAAERACKDPNPVIDGRK

Links
Other RRM family RBPs
Other *Ciona savignyi* RBPs

94 Related RBPs

Due to potential differences in protein isoforms or tested constructs, some RBPs without inferred motifs might appear in this list.
Name	Species	Gene ID	Motif Evidence	RBD Identity	Action
AAEL009912	Aedes aegypti	AAEL009912	N	0.000
AGAP004322	Anopheles gambiae	AGAP004322	N	0.000
CpipJ_CPIJ015135	Culex pipiens	CpipJ_CPIJ015135	N	0.000