CISBP-RNA Database: Catalog of Inferred Sequence Binding Preferences of RNA binding proteins

RBP Information

SNRPA *(Sus scrofa)* RRM
Pfam ID	Interpro ID	Gene ID	CISBP-RNA ID	Sequence source
PF00076 (RRM_1)	IPR000504	ENSSSCG00000002998	T41404_0.6	Ensembl (2011-Oct-26)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Sequence Logo	IUPAC	Type/Study/Study ID	RBD Identity
No direct experiments
Motifs from related RBPs
Name/Motif ID	Species	Sequence Logo	IUPAC	Type/Study/Study ID	RBD Identity
SNRPA M069_0.6	Homo sapiens		WUGCACR	RNAcompete Ray et al.(2013) RNCMPT00071	1.000
SNRPA M348_0.6	Homo sapiens		AGGAGAU	SELEX Cook et al.(2011) 949_10094314	1.000
SNRPA M347_0.6	Homo sapiens		GAGCAGUAGKS	SELEX Cook et al.(2011) 948_10094314	1.000
SNRPA M346_0.6	Homo sapiens		GGGUAUGCUG	SELEX Cook et al.(2011) 947_10094314	1.000
SNRPA M345_0.6	Homo sapiens		GWUWCCUGCUA	SELEX Cook et al.(2011) 946_10094314	1.000
SNRPA M319_0.6	Homo sapiens		AUUGCAC	SELEX Cook et al.(2011) 663_1717938	1.000
SNRPA M318_0.6	Homo sapiens		AUUGCAC	SELEX Cook et al.(2011) 662_1717938	1.000
SNRPA M317_0.6	Homo sapiens		AUUGCAC	SELEX Cook et al.(2011) 661_1717938	1.000
snf M136_0.6	Drosophila melanogaster		UWGCAC	RNAcompete Ray et al.(2013) RNCMPT00145	0.833
For this family, RBPs with RBD identity > 0.7* will likely have a similar motif*

RNA Binding Domains

Protein ID	Domain	From	To	Sequence
ENSSSCP00000003248	RRM	18	89	IYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMR
ENSSSCP00000003248	RRM	216	281	LFLTNLPEETNELMLSMLFNQFPGFKEVRLVPGRHDIAFVEFDNEVQAGAARDALQGFKITQNNAM

Links
Other RRM family RBPs
Other *Sus scrofa* RBPs

125 Related RBPs

Due to potential differences in protein isoforms or tested constructs, some RBPs without inferred motifs might appear in this list.
Name	Species	Gene ID	Motif Evidence	RBD Identity	Action
PPARGC1B	Choloepus hoffmanni	ENSCHOG00000005517	N	0.000
PPARGC1B	Myotis lucifugus	ENSMLUG00000013169	N	0.000